PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 292aa    MW: 33861.5 Da    PI: 9.3509
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093180.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.81.2e-283184255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeL e Fv+av++LGG+ekAtPk+il++m+vkgL ++h+kSHLQ+YR+
  XP_010093180.1 31 PRLRWTPELQELFVDAVRSLGGKEKATPKRILQTMSVKGLKISHIKSHLQMYRS 84
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0512787IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-272886IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-223185IPR006447Myb domain, plants
SuperFamilySSF466891.79E-133186IPR009057Homeodomain-like
PfamPF002499.3E-83283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MYCGLHDQVE TMEDAQNQRI GVRKYNKSEF PRLRWTPELQ ELFVDAVRSL GGKEKATPKR  60
ILQTMSVKGL KISHIKSHLQ MYRSMKDRDQ IDIFVRTRQY SSMKHLQEIH AQDRSRVFST  120
FFPQRPVGNE WMDFNHEICS QRRDGLRQTK EETSENNALQ VFSTMNRALN TLLDQVPREL  180
FAANKYAKPY GQVLNAQLID RESRALISMV KDTHISLLNN RPKVNEKFGL HQFCALSLPY  240
TPIIPRVEEK DVAIWQVANS RSISHSNSTC TSSDIQDVHS IQANDINLDL TI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093180.10.0Putative Myb family transcription factor
TrEMBLW9R0R40.0W9R0R4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.15e-24G2-like family protein